PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00020412-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 24564.8 Da    PI: 6.6723
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00020412-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.51.7e-28959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k ien++nrqvtfskR++g++KKA+ELSvLC+a+va+iifs tgk +eyss
  PSME_00020412-RA  9 KAIENTTNRQVTFSKRKTGLMKKAHELSVLCNAQVALIIFSATGKKFEYSS 59
                      68***********************************************96 PP

2K-box18.96.3e-0859953469
             K-box 34 eqRhllGedLesLs.lkeLqqLeqqLekslkkiRskK 69
                      + R ++GedL+ Ls  +++ +Le+ Le++  +iR +K
  PSME_00020412-RA 59 SSRYMKGEDLDLLSdTNQMANLENMLETATARIRRRK 95
                      5799*********86899******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.076161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-29276IPR002100Transcription factor, MADS-box
CDDcd002651.13E-38270No hitNo description
PRINTSPR004042.3E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRGKIEIKA IENTTNRQVT FSKRKTGLMK KAHELSVLCN AQVALIIFSA TGKKFEYSSS  60
RYMKGEDLDL LSDTNQMANL ENMLETATAR IRRRKVLECH SRMGKPVHGY TAAAPFCYQV  120
EQQQPQIPLH IIMPAAPPLP VKPSHPNSQD SGYPQPDLQL GYVEDVDLEV DVSKSSDVGV  180
EESNTSNFDK IEVGVNASCK SGDIGEDSNM SSGELSGGRR IIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-19160160Myocyte-specific enhancer factor 2B
1tqe_Q4e-19160160Myocyte-specific enhancer factor 2B
1tqe_R4e-19160160Myocyte-specific enhancer factor 2B
1tqe_S4e-19160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7110752e-58KJ711075.1 Pinus tabuliformis clone PtMADS2 MADS2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K0M6Z73e-78A0A0K0M6Z7_PINTB; MADS2 (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.21e-27MIKC_MADS family protein